return true; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ }, "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "actions" : [ LITHIUM.Dialog.options['-866379535'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetEditCommentForm", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); setWarning(pagerId); "parameters" : { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'R_lTM4wi6zqFI-aEUmqw_SLLVeMEzCLG3pOi5OPhbHc. { "truncateBodyRetainsHtml" : "false", o.innerHTML = "Page number can\'t exceed 2. "includeRepliesModerationState" : "false", "displayStyle" : "horizontal", "action" : "rerender" "disallowZeroCount" : "false", }, ] }, "actions" : [ "actions" : [ "actions" : [ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-84222 .lia-rating-control-passive', '#form'); "event" : "editProductMessage", }, ] }, "action" : "rerender" ] { "action" : "rerender" } "componentId" : "kudos.widget.button", ] LITHIUM.AjaxSupport.ComponentEvents.set({ { { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", "}); }, "initiatorDataMatcher" : "data-lia-kudos-id" "forceSearchRequestParameterForBlurbBuilder" : "false", } "disableLabelLinks" : "false", } .attr('aria-selected','true'); ], "actions" : [ "}); }, ] "disableLinks" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "linkDisabled" : "false" "action" : "rerender" { } else { "action" : "rerender" "event" : "kudoEntity", { } } "actions" : [ }, }, { "context" : "envParam:quiltName,message", ] "action" : "rerender" "context" : "", { }); { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":154201,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "parameters" : { } "actions" : [ { } "event" : "MessagesWidgetMessageEdit", "action" : "pulsate" "context" : "", "action" : "pulsate" "displayStyle" : "horizontal", "event" : "MessagesWidgetMessageEdit", { // We made it! "kudosLinksDisabled" : "false", "event" : "MessagesWidgetCommentForm", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" "useCountToKudo" : "false", }, } })(LITHIUM.jQuery); ] "event" : "addMessageUserEmailSubscription", } "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" }); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "context" : "envParam:entity", { } "actions" : [ ] "componentId" : "forums.widget.message-view", "context" : "", "context" : "", "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); } "eventActions" : [ { { Also available at Guide to Iceland at Reykjavík City Hall and at your nearest Arion branch. "entity" : "84222", ] }, "truncateBody" : "true", "actions" : [ "initiatorBinding" : true, { "actions" : [ { "revokeMode" : "true", { ] document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); ] LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); } ] "context" : "envParam:quiltName,expandedQuiltName", }); { { { { "action" : "rerender" } { { "includeRepliesModerationState" : "false", "actions" : [ "revokeMode" : "true", }, { "eventActions" : [ "context" : "envParam:feedbackData", { }); "context" : "", }, ;(function($) { "actions" : [ { "action" : "rerender" if ( neededkeys[count] == key ) { ] LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "context" : "", Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); }, "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "editProductMessage", "action" : "rerender" "context" : "", "actions" : [ "actions" : [ { }, "useSimpleView" : "false", } "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { ] { { "context" : "envParam:quiltName,product,contextId,contextUrl", disableInput(pagerId); { createStorage("false"); "eventActions" : [ "eventActions" : [ { "event" : "removeThreadUserEmailSubscription", ] Verlangen Sie dort gezielt die Vodafone TwinCard zu Ihrem Vertrag, diese können Sie jederzeit zu Ihrem Tarif bzw. "context" : "", { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); o.innerHTML = ""; { }, } "actions" : [ "action" : "rerender" "action" : "pulsate" lithadmin: [] ] { "actions" : [ }, { "event" : "approveMessage", }, LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-154205 .lia-rating-control-passive', '#form_8'); LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "action" : "rerender" count = 0; // If watching, pay attention to key presses, looking for right sequence. o.innerHTML = "Page must be in a numeric format. ] "event" : "AcceptSolutionAction", { } "displaySubject" : "true", "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", } } else { "displaySubject" : "true", } "context" : "", } { "useTruncatedSubject" : "true", } "action" : "rerender" { "action" : "rerender" "event" : "editProductMessage", { "action" : "rerender" { "showCountOnly" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); ] { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "event" : "QuickReply", "event" : "removeMessageUserEmailSubscription", "actions" : [ "disableLinks" : "false", { "initiatorDataMatcher" : "data-lia-kudos-id" } "actions" : [ $('#node-menu li.active').children('ul').show(); }, $(document).ready(function(){ }, "useTruncatedSubject" : "true", "actions" : [ }, { }, { "actions" : [ "action" : "pulsate" }, } })(LITHIUM.jQuery); }, } ] window.location.replace('/t5/user/userloginpage'); ] "action" : "rerender" "selector" : "#kudosButtonV2_3", "action" : "pulsate" "useCountToKudo" : "false", "action" : "rerender" LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "actions" : [ }, }, "event" : "ProductMessageEdit", "event" : "addThreadUserEmailSubscription", "context" : "", "eventActions" : [ }, "componentId" : "forums.widget.message-view", } ] } } { }, LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "}); { { "actions" : [ } } } } }, { "actions" : [ "disallowZeroCount" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" { { } { "actions" : [ "context" : "envParam:quiltName,message", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_69bae737b85ebd_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/4309&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, ] { { ', 'ajax'); { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Red Select Top Up + 800 Minutes Limitless SMSs 2GB. LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" ] { ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/4309","ajaxErrorEventName":"LITHIUM:ajaxError","token":"14cG3iRIspC2JI18AZ12L8g_MejX2yIl3QQFGvNcbIY. LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, '-Pwp1eIKgaQUAESpgd2OANuPBg0dLCfLxADdHWC-18Y. }, } "context" : "", "event" : "markAsSpamWithoutRedirect", "context" : "", { "includeRepliesModerationState" : "false", { })(LITHIUM.jQuery); "context" : "", "actions" : [ "useSimpleView" : "false", { }, { ] "actions" : [ ] } } "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "context" : "", }, { $(this).next().toggle(); }, Execute whatever should happen when entering the right sequence "event" : "ProductAnswer", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { { "actions" : [ }, LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "parameters" : { { LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); }, "componentId" : "forums.widget.message-view", { } { "displaySubject" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", return false; "action" : "rerender" "event" : "approveMessage", "displaySubject" : "true", "selector" : "#messageview_7", "event" : "approveMessage", { { }, "actions" : [ }, }, ] ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); } "context" : "envParam:quiltName", ], }, } "event" : "removeThreadUserEmailSubscription", { "disableKudosForAnonUser" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "lia-deleted-state", "actions" : [ "useTruncatedSubject" : "true", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "actions" : [ { "action" : "rerender" "event" : "approveMessage", "action" : "rerender" { "event" : "MessagesWidgetEditAnswerForm", } ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", // Set start to true only if the first key in the sequence is pressed "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" { { "actions" : [ { } "selector" : "#kudosButtonV2_5", { { "defaultAriaLabel" : "", { "action" : "pulsate" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-154205 .lia-rating-control-passive', '#form_8'); "dialogKey" : "dialogKey" if ( count == neededkeys.length ) { { ], }, ] } "action" : "rerender" "useSubjectIcons" : "true", } "action" : "rerender" ', 'ajax'); ', 'ajax'); { }, "action" : "rerender" ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", { } { "action" : "rerender" }, "initiatorBinding" : true, "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "displayStyle" : "horizontal", { { "event" : "removeThreadUserEmailSubscription", }, "event" : "markAsSpamWithoutRedirect", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "action" : "addClassName" "context" : "envParam:quiltName", } }, ] "parameters" : { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $(event.data.selector).addClass('cssmenu-open') LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/4309","ajaxErrorEventName":"LITHIUM:ajaxError","token":"EPtNnWU9ixYTR8qB8DBLXmCnFZdzNhTcXGjibM1a1uw. "event" : "AcceptSolutionAction", ], "action" : "rerender" }, { "actions" : [ } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, }, } "context" : "envParam:entity", }, "parameters" : { "actions" : [ return false; logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'T-x8gPrmEEfoO6NAHlXrpibCCAsDg1HKQ3WG1YX_KqQ. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'T-x8gPrmEEfoO6NAHlXrpibCCAsDg1HKQ3WG1YX_KqQ. ] { ] { if (1 != val) //} else { LITHIUM.Loader.runJsAttached(); "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" ] "action" : "rerender" "truncateBody" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "eventActions" : [ "action" : "rerender" "event" : "removeMessageUserEmailSubscription", { { "event" : "unapproveMessage", "actions" : [ { "context" : "envParam:entity", }, "useSubjectIcons" : "true", }); "event" : "ProductAnswerComment", if ( Number(val) < 1 ) { { return false; }, ] { "truncateBody" : "true", }, "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "disableKudosForAnonUser" : "false", { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_CallYa/thread-id/4309","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OMjg_bWCiJlUD-HD12ksnZBuGLEUedsJ2U-fIBC_s9E. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); { { "}); "action" : "rerender" "context" : "", "context" : "", } "context" : "", "event" : "removeThreadUserEmailSubscription", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ }, "actions" : [ }, }, ] ] o.innerHTML = "Page must be in a numeric format. "action" : "pulsate" }, } ] { { ] "context" : "", ] "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } { "context" : "envParam:quiltName", "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "disableLabelLinks" : "false", }); } "event" : "MessagesWidgetEditAction", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "componentId" : "kudos.widget.button", "action" : "rerender" }, "useSimpleView" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'nxhVVidbNj5ASo3s8iwKRJ7gTM_mbLR0JQlhvPJfT-U. "disableLabelLinks" : "false", }); "action" : "rerender" { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); } } if (isNaN(val) ) "context" : "envParam:entity", "parameters" : { { { { "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" "entity" : "154197", { }, watching = false; document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); } { "context" : "", "action" : "rerender" '; { ] "action" : "rerender" { ] "event" : "editProductMessage", "action" : "rerender" }, }, "actions" : [ { "action" : "rerender" ] "action" : "rerender" }); { { "kudosLinksDisabled" : "false", }); "event" : "QuickReply", { "event" : "MessagesWidgetAnswerForm", // We made it! ', 'ajax'); ] "initiatorDataMatcher" : "data-lia-kudos-id" if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "actions" : [ Trete ich in meiner Funktion als SuperUser auf, so ist dies durch kursive Schrift gekennzeichnet. "actions" : [ ] "parameters" : { { { "actions" : [ "action" : "addClassName" "actions" : [ }, createStorage("false"); ] } { "actions" : [ "useSimpleView" : "false", "event" : "editProductMessage", element.children('ul').slideDown(); { } }, }, ] "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. { }, '; { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "parameters" : { ] $('div[class*="-menu-btn"]').removeClass('active'); "initiatorBinding" : true, }, "selector" : "#messageview_1", { "event" : "MessagesWidgetEditAnswerForm", }, "actions" : [ "actions" : [ "actions" : [ "event" : "removeMessageUserEmailSubscription", }, "event" : "markAsSpamWithoutRedirect", } "useSimpleView" : "false", "context" : "", { } }, ] "event" : "markAsSpamWithoutRedirect", }, "event" : "addThreadUserEmailSubscription", { "action" : "rerender" { { "includeRepliesModerationState" : "false", "context" : "", "actions" : [ "actions" : [ } "kudosable" : "true", { "useSubjectIcons" : "true", { }, "context" : "lia-deleted-state", }); }, "action" : "rerender" { } "actions" : [ "context" : "envParam:quiltName", }, } // Oops, not the right sequence, lets restart from the top. } { }, "context" : "", return; "context" : "envParam:selectedMessage", "displaySubject" : "true", "context" : "", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-154201 .lia-rating-control-passive', '#form_7'); "actions" : [ } ] { Find great deals on eBay for vodafone card. "action" : "rerender" "action" : "rerender" "event" : "approveMessage", "actions" : [ "action" : "rerender" { "context" : "envParam:feedbackData", "actions" : [ "actions" : [ "event" : "MessagesWidgetAnswerForm", function clearWarning(pagerId) { ], "messageViewOptions" : "1111110111111111111110111110100101001101" "}); "linkDisabled" : "false" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/4309","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DKJSCUMfNIJKFBI9B_mByEtNX91sxVubCQQip2XHFNg. } "useSimpleView" : "false", "event" : "MessagesWidgetEditCommentForm", } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" { "action" : "rerender" }, { } ] ] "event" : "MessagesWidgetMessageEdit", "disallowZeroCount" : "false", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" ] { { LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ { } { "actions" : [ "includeRepliesModerationState" : "false", "action" : "rerender" }, "action" : "rerender" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"});