"revokeMode" : "true", } ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, { "includeRepliesModerationState" : "false", }, "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] LITHIUM.AjaxSupport.ComponentEvents.set({ }, }, { { "context" : "", "linkDisabled" : "false" } "actions" : [ }, "initiatorDataMatcher" : "data-lia-message-uid" }, ] "message" : "1536546", } "event" : "MessagesWidgetEditAction", ], { "truncateBody" : "true", ] LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }); }, LITHIUM.Dialog.options['1435473433'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "truncateBody" : "true", "event" : "approveMessage", { { { "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ }, "disableLabelLinks" : "false", ] // Reset the conditions so that someone can do it all again. "action" : "rerender" { if ( !watching ) { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "componentId" : "kudos.widget.button", "includeRepliesModerationState" : "false", } "actions" : [ }, "action" : "rerender" "actions" : [ ], }, "initiatorBinding" : true, "context" : "", ] "useCountToKudo" : "false", "event" : "unapproveMessage", } // Set start to true only if the first key in the sequence is pressed LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); } "event" : "unapproveMessage", ] LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:feedbackData", ] { "action" : "rerender" $(document).ready(function(){ "truncateBody" : "true", "event" : "MessagesWidgetCommentForm", } "actions" : [ "event" : "ProductAnswer", "disableLinks" : "false", "action" : "rerender" "action" : "rerender" }, createStorage("false"); { "event" : "kudoEntity", { }, "context" : "", { "event" : "ProductAnswerComment", }, "useSubjectIcons" : "true", $('#community-menu-toggle').click(function() { { ] ] }, "action" : "pulsate" "eventActions" : [ "actions" : [ "entity" : "1536474", ] "truncateBody" : "true", { "context" : "envParam:quiltName,expandedQuiltName", ] // Set start to true only if the first key in the sequence is pressed "context" : "envParam:quiltName", } else { } }, }); { "context" : "envParam:entity", "action" : "pulsate" ] // Oops. }, "actions" : [ { }, "context" : "envParam:quiltName", { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "event" : "expandMessage", }, "actions" : [ "event" : "RevokeSolutionAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" { } ['TABLET', 'Jetzt Internet-Flatrates beim Anbieter bestellen:'], LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'vUYqOgUeVlo7rrLgBpXdbDCjpRgK_3WVozbfDQ9GD2U. "parameters" : { "event" : "MessagesWidgetEditAction", "useSubjectIcons" : "true", { "linkDisabled" : "false" "action" : "rerender" ] "actions" : [ "quiltName" : "ForumMessage", ] { { "action" : "rerender" } } "context" : "", ] { { "context" : "envParam:quiltName,message", "eventActions" : [ "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1538806,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "truncateBodyRetainsHtml" : "false", { ] "context" : "envParam:quiltName", { }, "context" : "envParam:quiltName,message", "}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_31bab6a1ee3625","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "event" : "RevokeSolutionAction", { "actions" : [ "actions" : [ } { "context" : "", "event" : "MessagesWidgetAnswerForm", }, }, } { } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1536546,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, }, }, "disableKudosForAnonUser" : "false", { } "event" : "QuickReply", "message" : "1536494", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "eventActions" : [ "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "event" : "AcceptSolutionAction", "message" : "1538576", }, "displaySubject" : "true", "context" : "", "actions" : [ "eventActions" : [ "action" : "rerender" { { "eventActions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "kudosable" : "true", "actions" : [ { "context" : "", "action" : "rerender" "context" : "lia-deleted-state", "event" : "kudoEntity", "action" : "rerender" ] "selector" : "#messageview_8", { "actions" : [ "context" : "", "actions" : [ $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); "context" : "", { }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "parameters" : { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", } "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" ], } { "context" : "envParam:selectedMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ ] } } }, { "actions" : [ "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", } // console.log(key); { "useSubjectIcons" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] "kudosable" : "true", { "actions" : [ ] "context" : "envParam:selectedMessage", "action" : "rerender" ] "displaySubject" : "true", }, }, "event" : "MessagesWidgetAnswerForm", } { ] "actions" : [ { } } "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] { "event" : "removeThreadUserEmailSubscription", "parameters" : { }, LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "event" : "MessagesWidgetAnswerForm", } "context" : "envParam:quiltName,expandedQuiltName", $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1536483,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $(document).ready(function(){ "linkDisabled" : "false" }, LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "action" : "rerender" { { "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:quiltName", "action" : "rerender" "action" : "rerender" "initiatorBinding" : true, { "event" : "AcceptSolutionAction", "action" : "rerender" "componentId" : "kudos.widget.button", { { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "action" : "rerender" In Verbindung mit Daten-Optionen, die zu einem Sprachtarif hinzugebucht wurden, ist { } "displaySubject" : "true", "kudosLinksDisabled" : "false", "action" : "rerender" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", "displayStyle" : "horizontal", ] { "actions" : [ "truncateBodyRetainsHtml" : "false", { "actions" : [ { "actions" : [ "activecastFullscreen" : false, "includeRepliesModerationState" : "false", "context" : "envParam:selectedMessage", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "context" : "", "initiatorBinding" : true, "parameters" : { "actions" : [ "componentId" : "kudos.widget.button", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "action" : "addClassName" }, ] ], }, { "context" : "", "event" : "addMessageUserEmailSubscription", }, "action" : "rerender" { { "selector" : "#kudosButtonV2_8", "event" : "approveMessage", "parameters" : { "truncateBody" : "true", "event" : "ProductAnswerComment", { { ] "selector" : "#messageview_7", "event" : "removeMessageUserEmailSubscription", "event" : "addMessageUserEmailSubscription", "eventActions" : [ }, } { ] "selector" : "#kudosButtonV2_7", }, }, }, { } "context" : "envParam:selectedMessage", { "action" : "rerender" return; "componentId" : "kudos.widget.button", "context" : "envParam:entity", { { { }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; return; "context" : "", "disableKudosForAnonUser" : "false", { { } ] ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductAnswer", "event" : "MessagesWidgetEditAnswerForm", "useSubjectIcons" : "true", }, "context" : "", }else{ "event" : "MessagesWidgetEditAnswerForm", "componentId" : "forums.widget.message-view", { } "event" : "MessagesWidgetMessageEdit", LITHIUM.Dialog({ "actions" : [ "initiatorBinding" : true, { { "context" : "envParam:entity", "context" : "", "actions" : [ "eventActions" : [ "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/193129","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qH6imjKbMcxhvpC5IrWgPiUaRTK8kgOADyw966rzVxs. "action" : "rerender" } "context" : "", "action" : "rerender" "event" : "QuickReply", }, ] ] count++; "action" : "rerender" { } { "actions" : [ } { "actions" : [ { $(document).keydown(function(e) { } "useSubjectIcons" : "true", if ( key == neededkeys[0] ) { } "action" : "rerender" "}); { }, "truncateBodyRetainsHtml" : "false", } }); } "context" : "envParam:feedbackData", "actions" : [ "action" : "rerender" "action" : "rerender" ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/193129","ajaxErrorEventName":"LITHIUM:ajaxError","token":"rcdJUmgDjPoywhKk7Yzhj5LRys9zZ1SFWtKjxVITakc. LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); } "action" : "pulsate" LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "actions" : [ "actions" : [ "action" : "pulsate" }, } } } ] "event" : "MessagesWidgetEditCommentForm", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233531}); "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", }, }); // We made it! { "dialogContentCssClass" : "lia-panel-dialog-content", } "action" : "rerender" { "context" : "envParam:quiltName", { "action" : "rerender" "actions" : [ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "action" : "rerender" "action" : "addClassName" "action" : "rerender" ;(function($) { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1487,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewlbWw4EQgpebxtnCUIUWFEDEFNJcEFHUxFMOhZGBk9HOBoCAQFTAlENEE5AURZUXlF7ARRcCABRUgJUDQIHBlIFShtZATdEAUd6UBBfG1cVEAkBZwVSVnpTCFNEAxAkDUURWGdbQgxVNlhVB0AbRl5QeV0HXwpcEFhAUQVZQFEQSRQNWnANFhVeF1VVXhZTRBUQCQFjHBcJFlZcV1ZaVlZbGgIDUg0fUQYCDB8DVQdQGAFVVFMHXgoAAVBUABcfFlkGeAldVysGFV4XckZRDV8QZn8NAF4IU0ZaWUcaRFJRMAdEEGMBZUcARB8bCEAxcihwcGASDFJGf2AtLxcJUEBHUwJTFRllKidlIRVHW0IMVUhQVl9dFyh8fn1mRQlERE8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { } } "context" : "envParam:feedbackData", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }); "context" : "", "event" : "removeMessageUserEmailSubscription", { "actions" : [ { "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.AjaxSupport.useTickets = false; "context" : "envParam:quiltName,message,product,contextId,contextUrl",